Nilson Nunes Tavares

Possui graduação em Quimica Licenciatura e Bacharelado - Faculdades de Humanidades Pedro II (1990), Mestrado em Ciências Biológicas (Biofísica) pela Universidade Federal do Rio de Janeiro (1996) e Doutorado em Ciências Biológicas pela Universidade Federal do Rio de Janeiro (2002). Técnico Químico da Universidade Federal do Rio de Janeiro (1985-....). Pós Doutor na Ècole Normale Superieure-Paris (2004-2006). Professor temporário na Universidade Estadual da Zona Oeste (UEZO), na área de Drogas (2006-2009), Professor temporário de Química Inorgânica e Analítica Curso em Gestão Ambiental para o FAETERJ / Paracambi (2010 - 2014). Professor de Quimica da SEEDUC-RJ (2015-2016). Tem experiência na área de Biofísica com ênfase em Processos e Sistemas; Neuroquímica, atuando principalmente nos seguintes temas: Electrophorus electricus (L.), Acetilcolina, colina acetiltransferase, acetilcolinesterase, doença de Alzheimer, neurodegeneração, estresse oxidativo no sistema nervoso central. Membro do Instituto Nacional de Neurociência Translacional (INNT). Atua como Pos Doutor nos projetos do Laboratorio de Neuroquímica-IBCCF-UFRJ.

Informações coletadas do Lattes em 21/10/2019

Acadêmico

Seção coletada automaticamente pelo Escavador

Formação acadêmica

Doutorado em Ciências Biológicas (Biofísica)

1997 - 2002

Universidade Federal do Rio de Janeiro
Título: Efeito do Mercúrio (Hg2+) e Antidepressivos Tricíclicos Aromáticos sobre as enzimas de síntese e degradação da Acetilcolina do órgão elétrico do Electrophurus electricus (L.)
Aída Hassón-Voloch. Palavras-chave: Acetilcolina; Colina Acetiltransferase; Antidepressivos Aromáticos; Metais Pesados; Acetilcolinesterase; Neurotransmissão. Grande área: Ciências BiológicasSetores de atividade: Neurociências.

Mestrado em Ciências Biológicas (Biofísica)

1993 - 1996

Universidade Federal do Rio de Janeiro
Título: Caracterização Físicoquímica da Colina Acetiltransferase do órgão elétrico do Electrophorus electricus (L.),Ano de Obtenção: 1996
Orientador: Aída Hassón-Voloch
Palavras-chave: Colina Acetiltransferase; Síntese de Acetilcolina; Electrophorus electricus L; ChAT.Grande área: Ciências BiológicasSetores de atividade: Neurociências.

Graduação em Quimica Licenciatura e Bacharelado

1987 - 1990

Faculdades de Humanidades Pedro II

Seção coletada automaticamente pelo Escavador

Pós-doutorado

2015

Pós-Doutorado. , Universidade Federal do Rio de Janeiro, UFRJ, Brasil. , Grande área: Ciências Biológicas, Grande Área: Ciências Biológicas / Área: Biofísica / Subárea: Neuroquimica.

2010 - 2014

Pós-Doutorado. , Universidade Federal do Rio de Janeiro, UFRJ, Brasil. , Grande área: Ciências Biológicas

2006 - 2009

Pós-Doutorado. , Universidade Federal do Rio de Janeiro, UFRJ, Brasil. , Grande área: Ciências Biológicas, Grande Área: Ciências Biológicas / Área: Bioquímica. , Grande Área: Ciências Biológicas / Área: Biofísica.

2004 - 2006

Pós-Doutorado. , Ecole Normale Superieure - Paris, ENS- PARIS, França. , Bolsista do(a): Coordenação de Aperfeiçoamento de Pessoal de Nível Superior, CAPES, Brasil.

2002 - 2004

Pós-Doutorado. , Universidade Federal do Rio de Janeiro, UFRJ, Brasil. , Grande área: Ciências Biológicas

Seção coletada automaticamente pelo Escavador

Idiomas

Inglês

Compreende Bem, Fala Bem, Lê Bem, Escreve Bem.

Espanhol

Compreende Bem, Fala Pouco, Lê Bem, Escreve Pouco.

Português

Compreende Bem, Fala Bem, Lê Bem, Escreve Bem.

Francês

Compreende Bem, Fala Bem, Lê Bem, Escreve Bem.

Seção coletada automaticamente pelo Escavador

Áreas de atuação

    Grande área: Ciências Biológicas / Área: Biofísica / Subárea: Biofísica de Processos e Sistemas.

    Grande área: Ciências Biológicas / Área: Bioquímica.

    Grande área: Ciências Exatas e da Terra / Área: Química.

    Grande área: Ciências Biológicas / Área: Bioquímica / Subárea: Biologia Molecular.

    Grande área: Ciências Biológicas / Área: Bioquímica / Subárea: Neuroquimica.

Seção coletada automaticamente pelo Escavador

Organização de eventos

Nunes-Tavares. N. . FEMUCTI. 2016. .

Costa Rodrigues, W. ; Izolani, A.O. ; Nunes-Tavares. N. . Semana Nacional de Tecnologia - IST Paracambi. 2011. (Outro).

Albuquerque, X.E. ; Oliveira Godinho, R. ; Nunes-Tavares. N. ; MASSOULIÉ, Jean ; CASTRO, N. G. . XIII International Symposium on Cholinergic Mechanism. 2008. (Congresso).

Seção coletada automaticamente pelo Escavador

Participação em eventos

IV Simposio Internacional Fronteiras da Neurociencias. 2017. (Simpósio).

9th IBRO. CHARACTERIZATION OF THE CONTENT AND ACTIVITY OF STRIATAL CHOLINERGIC ENZYMES IN A MOUSE EXPERIMENTAL MODEL OF PARKINSON'S DISEASE INDUCED BY 6-OHDA. 2015. (Congresso).

V FEMUCTI. Avaliador de trabalhos. 2015. (Feira).

XXX Reuniao da Federaçao das Sociedades de Biologia Experimental - FeSBE. A Proteina Cinase C Modula os Fenotipos Colinergicos em cultura da Retina de Ratos.. 2015. (Congresso).

IV FEMUCTI. Comissao julgadora. 2014. (Feira).

Semana Nacional de Ciencia e Tecnologia.Representante Institucional FAETERJ Paracambi. 2014. (Outra).

IIIFEMUCTI. Comissao julgadora. 2013. (Feira).

Feira Municipal de Ciencia e Tecnologia.Comite julgador e avaliador. 2012. (Encontro).

8th IBRO World Congress of Neuroscience - International Brain Research Organization. Inhibition of Choline Acetyltransferase as a Mechanism for ADDLs Induced Cholinergic Dysfunction.. 2011. (Congresso).

Semana Nacional de Ciencia e Tecnologia.Metais Pesados e suas implicaçoes para a saúde do Cérebro. 2011. (Seminário).

XIII Encontro Regional da Sociedade Brasileira de Quimica.Análise da Contaminação por Cátions de Metais Alcalinos, Metais Alcalinos Terrosos, e Metais Pesados na Água do Rio dos Macacos ? Paracambi ? RJ. 2011. (Encontro).

Frontiers in Neuroscience Symposium. 2010. (Simpósio).

XXXIV Congresso Anual da Sociedade Brasileira de Neurociencias e Comportamento. Regulation of acetylcholinesterase and choline acetyltransferase by glucuronoxylomannan, the immunodominant polysaccharide produced by the neuropathogen Cryptococcus neoformans.. 2010. (Congresso).

Symposiun in honor of Dr Jean Massoulié and Patrick Masson.A conference in Honor of Jean Massoulié. 2008. (Simpósio).

XIII International Symposium on Cholinergic Mechanism.mCutA, acetylcholinesterase and secretory trafficking. 2008. (Simpósio).

XIII ISCM.Homenagem à Dra Aida Hassón-Voloch. 2008. (Simpósio).

XXIII Reuniao Anual das Sociedades de Biologia Experimental-FeSBE. Aida Hassón Voloch - Uma Biofisica Brasileira. 2008. (Congresso).

IXth International Meeting on Cholinesterases. Identification of transcription factor promyelocytic Zinc finger (PLZF) as binding partner of proline membrane anchor (PRiMA) of acetylcholinesterase. 2007. (Congresso).

XXII Reunião Anual das Sociedades de Biologia Experimental (FeSBE). Polyunsaturated fatty acids prevent the inhibition of choline acetyltransferase (ChAT) by glutamate. 2007. (Congresso).

XXXII Reunião da Sociedade Brasileira de Biofisica. 2007. (Congresso).

XXI FeSBE. XXI Reunião Anual da Federação de Sociedades de Biologia Experimental (FeSBE). 2006. (Congresso).

II Journée d'Etuients d'ENS.II Journée d' Etudients d'ENS. 2005. (Encontro).

Journées des Etudiants du Departament de Biologie de L'ENS/IFR 36.Identification of novel binding partner(s) for the Proline Rich Membrane Anchor (PRiMA) of AChE using Yeast two hybrid system. 2005. (Simpósio).

XII INTERNATIONAL SYMPOSIUM ON CHOLINERGIC MECHANISMS.XII INTERNATIONAL SYMPOSIUM ON CHOLINERGIC MECHANISMS. 2005. (Simpósio).

XX FeSBE. XX FeSBE - Modulo Tematico. 2005. (Congresso).

XX FESBE. XX FESBE. 2005. (Congresso).

VIII International Meeting on Cholinesterases. VIII International Meeting on Cholinesterases. 2004. (Congresso).

V IberoAmerican Congress of Biophysics. V Congresso,Ibero-Americano de Biofisica. 2003. (Congresso).

XVIII FESBE. XVIII FESBE. 2003. (Congresso).

V Jornada Cientifica.V Jornada Cientifica I Conferencia Carlos Chagas Filho. 2002. (Encontro).

XIV International Congress of Biophysics. XIV International Congress of Biophysics. 2002. (Congresso).

XVII Reunião Anual da Federação de Sociedades de Biologia Experimental. XVII FESBE. 2002. (Congresso).

ISN Rio Satellite Symposium.International Society for Neurochemistry Rio - satellite Symposium: "Cell communication in the Nervous System - Function and Dysfunction". 2001. (Simpósio).

XVI Reunião da Federação de Sociedades de Biologia Experimental. XVI FESBE. 2001. (Congresso).

XXII Jornada de Iniciação Cientifica.XXII Jornada de Iniciação Cientifica. 2001. (Outra).

IV Biophysics Congress of Southern Cone. IV Biophysics Congress of the Southern Cone. 2000. (Congresso).

XV Reunião Anual da Federação de Sociedades de Biologia Experimental. XV FESBE. 2000. (Congresso).

XXI Jornada de Iniciação Cientifica.XXI Jornada de Iniciação Cientifica. 2000. (Outra).

XIII Reunião Anual da Federação de Sociedades de Biologia Experimental. XIII FESBE. 1998. (Congresso).

XII Reunião Anual da Federação de Sociedades de Biologia Experimental. XII FESBE. 1997. (Congresso).

XII International Biophysics Congress. XII International Biophysics Congress. 1996. (Congresso).

IX Reunião Anual da Federação de Sociedades de Biologia Experimental. IX FESBE. 1994. (Congresso).

V FeSBE. V Reunião Anual da Federação de Sociedades de Biologia Experimental. 1990. (Congresso).

Seção coletada automaticamente pelo Escavador

Participação em bancas

Aluno: Sula Vieira Bitencourt

SERFATY, C. A.; GIESTAL-DE-ARAUJO, ELIZABETH; RODRIGUES, A. S.; PEREIRA, M. R.;Nunes-Tavares. N.. Ativação Colinergica modula os niveis dos receptores muscarinicos M1 da IL4 e do BNDF em células da retina de ratos mantidas em culturas. 2017. Dissertação (Mestrado em Programa de Pós Graduação em Neurociencias) - Universidade Federal Fluminense.

Aluno: André Luiz Martins

IZOLANI, A. O.; CARRARO, V. M.;Nunes-Tavares. N.. OBTENÇÃO DE NITRATO DE PRATA A PARTIR DA RECICLAGEM DE CHAPAS RADIOGRÁFICAS. 2015. Dissertação (Mestrado em Mestrado Profissional) - UNIVERSIDADE DE VASSOURAS.

Aluno: THALITA MÁZALA DE OLIVEIRA

RIBEIRO, M. G. L.;Nunes-Tavares. N.; RABELO, A. A. S.. TRATAMENTO COM OUABAÍNA MODULA OS NÍVEIS DE TNFα EM CÉLULAS DA RETINA. 2014. Dissertação (Mestrado em Neuroimunologia) - Universidade Federal Fluminense.

Aluno: Ana Carolina Fernandes

TAVARES, A. L.; CAMPELLO-COSTA, P.;Nunes-Tavares. N.. Alterações temporais do sistema dopaminérgico e colinérgico em modelo da doença de Parkinson.. 2013.

Aluno: Sheila Maturana Teixeira

Nunes-Tavares. N.; De Souza Pereira, H.; LEAO-Ferreira, L. R.. Estudo da Atividade (Na+/K+)ATPásica durante o desenvolvimento do sistema nervoso: Efeito do IGF-I. 2010. Dissertação (Mestrado em Programa de Neuroimunologia) - Universidade Federal Fluminense.

Aluno: Eliezer de Mello Silva

RABELO, A. A. S.;Nunes-Tavares. N.; RUMJANEK, V. B.; SANTOS, P. C. B. D.. "Ação modulatória de IGF-1 e EGF sobre os níveis de BDNF e IL-4 em culturas de retinas de ratos neonatos". 2015. Tese (Doutorado em Pos Garduaçao em Neurociencias/UFF) - Universidade Federal Fluminense.

Nunes-Tavares. N.; Sa Barreto. Concurso Publico para professor Temporario do Centro Universitario da Zona Oeste - UEZO. 2008. Universidade Estadual da Zona Oeste.

SLANA, Glaucia; Sa Barreto;Nunes-Tavares. N.. Concurso Publico para Professor Temporario do Centro Universitario da Zona Oeste (UEZO). 2007. Universidade Estadual da Zona Oeste.

Seção coletada automaticamente pelo Escavador

Comissão julgadora das bancas

Maria Christina Fialho de Mello

DE MELLO, M. C. F.. Efeito do mercúrio (Hg2+) e antidepressivos tricíclicos aromáticos sobre as enzimas de síntese e degradação da acetilcolina no órgão elétrico do Electrophorus electricus (L.).. 2002. Tese (Doutorado em Ciências Biológicas (Biofísica)) - Universidade Federal do Rio de Janeiro.

Patricia Franca Gardino

Gardino, P.F.. Caracterização físico-química da colina acetiltransferase do órgão elétrico do Electrophorus electricus (L.). 1996. Dissertação (Mestrado em Ciências Biológicas (Biofísica)) - Universidade Federal do Rio de Janeiro.

Ricardo Augusto de Melo Reis

REIS, R. A.; CARVALHO, R. P.;HOKOÇ, J. N.. Efeito do Mercúrio (Hg2+) e antidepressivos tricíclicos aromáticos sobre as enzimas de síntese e degradação da acetilcolina do órgão elétrico do Electrophorus electricus (L.). 2002. Tese (Doutorado em Ciências Biológicas (Biofísica)) - Universidade Federal do Rio de Janeiro.

Roberto Paes de Carvalho

Paes-de-Carvalho,R. Tese de doutorado. 2002. Tese (Doutorado em Ciências Biológicas (Biofísica)) - Universidade Federal do Rio de Janeiro.

Seção coletada automaticamente pelo Escavador

Orientou

Luis Eduardo da Silva Santos

INIBIÇÃO DA COLINA ACETILTRANSFERASE POR OLIGÔMEROS SOLÚVEIS DE Aβ: POSSÍVEL CAUSA DE DISFUNÇÃO COLINÉRGICA NO SISTEMA NERVOSO CENTRAL; 2011; Dissertação (Mestrado em Biofisica) - Instituto de Biofisica Carlos Chagas Filho - UFRJ, Conselho Nacional de Desenvolvimento Científico e Tecnológico; Coorientador: Nilson Nunes Tavares;

Camila Pinheiro de Almeida

Papel do Estresse Oxidativo induzido por glutamato na disfunção colinérgica no sistema nervos central; 2008; Dissertação (Mestrado em Pos Graduação em Ciencia Biologicas) - Instituto de Biofisica Carlos Chagas Filho, Conselho Nacional de Desenvolvimento Científico e Tecnológico; Coorientador: Nilson Nunes Tavares;

Maria Antónia Rodrigues

Home Care e Qualidade de Vida; 2016; Monografia; (Aperfeiçoamento/Especialização em Auditoria Hospitalar) - Faculdade Sao Camilo; Orientador: Nilson Nunes Tavares;

Yone Camargo Abder Rahman

Planos de Autogestao como estrategia para garantia de acesso à saude dos Funcionarios dos Correios; ; 2016; Monografia; (Aperfeiçoamento/Especialização em Auditoria Hospitalar) - Faculdade Sao Camilo; Orientador: Nilson Nunes Tavares;

Karliane Elias Santos e Taiane Sarandy da Silva

A Importancia da Gestao de Suprimentos Hospitalares; 2015; Monografia; (Aperfeiçoamento/Especialização em MBA em Gestao de Saude) - Centro Universitário São Camilo; Orientador: Nilson Nunes Tavares;

Adalto de Andrade Ferreira e Claudia Bitencourt

A importancia da Enfermagem atuandona auditoria de contas das Instituiçoes Privadas; 2014; Monografia; (Aperfeiçoamento/Especialização em Pos Graduaçao Auditoria em Sistemas de Saúde) - Faculdade Sao Camilo; Orientador: Nilson Nunes Tavares;

Silaine de Mello Ribeiro

A Importância da evolução do enfermeiro no processo auditoria; 2013; Monografia; (Aperfeiçoamento/Especialização em Pos Garduaçao em Administraçao) - Faculdade Sao Samilo; Orientador: Nilson Nunes Tavares;

Francine dos Santos José

A IMPORTÂNCIA DO ENFERMEIRO AUDITOR PARA AS OPERADORAS DE SAÚDE NA AUTORIZAÇÃO DOS SERVIÇOS DE HOME CARE; 2013; Monografia; (Aperfeiçoamento/Especialização em Pos Graduaçao Auditoria em Sistemas de Saúde) - Centro Universitário São Camilo; Orientador: Nilson Nunes Tavares;

NATHALIA ALVES DE MAGALHÃES CUNHA

AUDITORIA COMO INSTRUMENTO PARA MELHORIA DA ASSISTÊNCIA DE ENFERMAGEM; ; 2013; Monografia; (Aperfeiçoamento/Especialização em Pos Graduaçao Auditoria em Sistemas de Saúde) - Centro Universitário São Camilo; Orientador: Nilson Nunes Tavares;

Vinicios Cortez Silva

PROPOSTA DE TRATAMENTO DO ESGOTO NAS DEPENDÊNCIAS DO COMPLEXO ACADÊMICO DE PARACAMBI, A PARTIR DE UM REATOR ANAERÓBIO DE FLUXO ASCENDENTE (RAFA); ; 2012; Monografia; (Aperfeiçoamento/Especialização em Tecnologo em Gestao Ambiental) - Faculdade de Ensino Tecnológico do Estado do Rio de Janeiro; Orientador: Nilson Nunes Tavares;

Leticia Luciano

IMPORTÂNCIA DA ANÁLISE DE ÁGUA PARA A SAÚDE PÚBLICA; ANÁLISE MICROBIOLÓGICA E FÍSICO-QUÍMICO DAS ÁGUAS EM ESCOLAS DE PARACAMBI-RJ; ?; 2013; Trabalho de Conclusão de Curso; (Graduação em Tecnologo em Gestao Ambiental) - Faculdade de Ensino Tecnológico do Estado do Rio de Janeiro; Orientador: Nilson Nunes Tavares;

[Nome removido após solicitação do usuário]

A DIVERSIDADE DA FLORA EPIFÍTICA E O USO DA TILLANDSIA USNEOIDES NA AVALIAÇÃO DA QUALIDADE DO AR EM PARACAMBI/RJ; 2012; Trabalho de Conclusão de Curso; (Graduação em Gestão Ambiental) - Faculdade de Ensino Tecnológico do Estado do Rio de Janeiro; Orientador: Nilson Nunes Tavares;

Camila Pinheiro de Almeida

Estresse oxidativo induzido por ativação de receptores glutamatérgicos regula a atividade da Colina Acetiltransferase; 2006; Trabalho de Conclusão de Curso - Universidade Federal do Rio de Janeiro, Conselho Nacional de Desenvolvimento Científico e Tecnológico; Orientador: Nilson Nunes Tavares;

Rafael Ramos Hospodar Felipe Valverde

Colina Acetiltransferasedo Orgão elétrico do Electrophorus electricus (L; ): Inibição pelo Hg2+ e sua reversão; ; 2001; Trabalho de Conclusão de Curso; (Graduação em Biologia) - Universidade Federal do Rio de Janeiro, Conselho Nacional de Desenvolvimento Científico e Tecnológico; Orientador: Nilson Nunes Tavares;

Camila Pinheiro de Almeida

Estresse Oxidativo induzido por ativaçao de receptores glutamatérgicos regula a atividade da ChAT em retina de aves; 2005; Iniciação Científica; (Graduando em Biociencias) - Universidade Federal do Rio de Janeiro, Conselho Nacional de Desenvolvimento Científico e Tecnológico; Orientador: Nilson Nunes Tavares;

Joyce da Silva Dias

Caracterizaçao da Isoforma a-3 da enzima Na+,K+ ATPase no orgao eletrico do Electrophorus electricus (L); 2003; Iniciação Científica; (Graduando em Enfermagem) - Universidade Federal do Rio de Janeiro; Orientador: Nilson Nunes Tavares;

Rafael Hospodar Felipe Valverde

Colina Acetiltransfearse do orgao eletrico de E; electricus (L): Inibiçao por Mercurio (Hg+2); 2000; Iniciação Científica; (Graduando em Biologia) - Instituto de Biofisica Carlos Chagas Filho - UFRJ, Conselho Nacional de Desenvolvimento Científico e Tecnológico; Orientador: Nilson Nunes Tavares;

Betina Manhães Pacheco

Estagio de Conclusao de curso Técnico; 2010; Orientação de outra natureza; (Técnico em Química) - Colegio Casemiro de Abreu; Orientador: Nilson Nunes Tavares;

Seção coletada automaticamente pelo Escavador

Foi orientado por

Aida Hassón Voloch

Caracterização Físico-Química da Colina Acetiltransferase do Órgão Elétrico do Electrophorus Electricus (L; ); 1996; Dissertação (Mestrado em Ciências Biológicas (Biofísica)) - Universidade Federal do Rio de Janeiro,; Orientador: Aida Hassón Voloch;

Aida Hassón Voloch

Efeito do Mercúrio (Hg+2) e Antidepressivos Tricíclicos sobre as enzimas de Síntese e Degradação da Acetilcolina no Órgão elétrico do Electrophorus electricus (L; ); 2002; Tese (Doutorado em Ciências Biológicas (Biofísica)) - Universidade Federal do Rio de Janeiro,; Orientador: Aida Hassón Voloch;

Fernando Garcia de Mello

Início: 2011; Universidade Federal do Rio de Janeiro;

Seção coletada automaticamente pelo Escavador

Produções bibliográficas

  • CLINE, ERIKA N. ; DAS, ARIGHNO ; BICCA, MAÍRA ASSUNÇÃO ; MOHAMMAD, SAAD N. ; SCHACHNER, LUIS F. ; KAMEL, JOSETTE M. ; DINUNNO, NADIA ; WENG, ANTHEA ; PASCHALL, JACOB D. ; LO BU, RIANA ; KHAN, FARAZ M. ; ROLLINS, MADELINE G. ; IVES, ASHLEY N. ; SHEKHAWAT, GAJENDRA ; NUNES-TAVARES, NILSON ; DE MELLO, FERNANDO G. ; COMPTON, PHILIP D. ; KELLEHER, NEIL L. ; KLEIN, WILLIAM L. . A Novel Crosslinking Protocol Stabilizes Amyloid β Oligomers Capable of Inducing Alzheimer's-Associated Pathologies. JOURNAL OF NEUROCHEMISTRY , v. 001, p. 30565253, 2019.

  • GRANJA, MARCELO GOMES ; BRAGA, LUIS EDUARDO GOMES ; CARPI-SANTOS, RAUL ; DE ARAUJO-MARTINS, LEANDRO ; NUNES-TAVARES, NILSON ; CALAZA, KARIN C. ; DOS SANTOS, ALINE ARAUJO ; GIESTAL-DE-ARAUJO, ELIZABETH . IL-4 Induces Cholinergic Differentiation of Retinal Cells In Vitro. Cellular and Molecular Neurobiology , v. 35, p. 0001, 2015.

  • Nunes-Tavares. N. ; SANTOS, L. E. S. ; SANTOS, L. E. ; Stutz, B. ; BRITO-MOREIRA, J. ; Klein, W. L. ; FERREIRA, S. T. ; DE MELLO, F. G. . Inhibition of Choline Acetyltransferase as a Mechanism for Cholinergic Dysfunction Induced by Amyloid-  Peptide Oligomers. The Journal of Biological Chemistry (Print) , v. 287, p. 19377-19385, 2012.

  • Nunes-Tavares. N. ; Liang, D. ; Xie,H.Q. ; Carvalho,S. ; Bon,S. ; MASSOULIÉ, Jean . Protein CutA Undergoes an Unusual Transfer into the Secretory Pathway and Affects the Folding, Oligomerization, and Secretion of Acetylcholinesterase. The Journal of Biological Chemistry (Print) , v. 284, p. 5195-5207, 2008.

  • Nunes-Tavares. N. ; SOUZA, Maisa L. S. ; FREITAS, Cristiano F. ; HASSON-VOLOCH, Aida ; NASCIUTTI, Luiz E. ; SILVA, Luiz-claudio F. . Identification and distribution of chondroitin sulfate in the three electric organs of the electric eel, Electrophorus electricus (L.). Comparative Biochemistry and Physiology. Part B: Biochemistry & Molecular Biology (Print) , New York, v. 146, p. 227-233, 2007.

  • Nunes-Tavares. N. ; VALVERDE, R. R. H. F. ; ARAUJO, G. M. N. ; HASSON-VOLOCH, A. . Toxicity induced by Hg2+ on Choline Acetyltransferase activity from E. electricus (L.) electrocyte - Protective effect of 2,3 Dimercapto-propanol (BAL).. Medical Science Monitor , Estados Unidos, v. 11, n.4, p. 2005;11(4)BR100, 2005.

  • Nunes-Tavares. N. ; Lowe, J. ; ARAUJO, G. M. N. ; PEDRENHO, A. R. ; RIBEIRO, M. G. L. ; HASSONVOLOCH, A. . Polarized distribution of Na+, K+-ATPase α-subunit isoforms in electrocyte membranes. Biochimica et Biophysica Acta. Biomembranes , v. 1661, n.1, p. 40-46, 2004.

  • Nunes-Tavares. N. ; NERY-DA-MATTA, A. R. ; BATISTA-E-SILVA, C. M. ; ARAUJO, G. M. N. ; LOURO, S. R. W. ; HASSON-VOLOCH, A. . Inhibition of acetylcholinesterase from Electrophorus electricus (L.) by tricyclic antidepressants. International Journal of Biochemistry & Cell Biology , v. 34, n.9, p. 1071-1079, 2002.

  • Nunes-Tavares. N. ; CUNHAESILVA, N. L. ; HASSON-VOLOCH, A. . Choline Acetiltransferase detection in Normal and Denervated eletrocyte from Electrophorus electricus (L.) using a confocal scanning optical microscopy analysis.. Anais da Academia Brasileira de Ciências , v. 72, n.3, p. 331-340, 2000.

  • Nunes-Tavares. N. ; BATISTA-E-SILVA, C. M. ; NERY-DA-MATTA, A. R. ; SIMONE, S. G. ; HASSON-VOLOCH, A. . Purification and partial characterization of creatine kinase from electric organ of Electrophorus electricus (L.). International Journal of Biochemistry & Cell Biology , Inglaterra, v. 32, p. 427-433, 2000.

  • Nunes-Tavares. N. ; HASSON-VOLOCH, A. . Choline Acetyltransferase from electric organ of Electrophorus electricus (L.) - Physicochemical Characterization and Immunochemical identification.. Zeitschrift für Naturforschung. C, A Journal of Biosciences , Alemanha, v. 53, p. 407-415, 1998.

  • Nunes-Tavares. N. . Acetylcholinesterase in Neurological Diseases. In: Dr Mahira Parveen; Santosh Kumar. (Org.). Recent Trends in Acetylcholinesterase System. Amsterdan: IOS Press, Netherlands, 2005, v. 7, p. -.

  • ARAUJO, S. E. ; Nunes-Tavares. N. ; SERFATY, C. A. ; SHOLL-FRANCO, A. ; Campello-COSTA, P. C. . Interleukin-2 induces plasticity of retino-collicular pathway: Cholinergic and glutamatergic systems involvement.. In: International Neuroscience, 2012, New Orleans. Abstract book. New Orleans, 2012.

  • Nunes-Tavares. N. ; SANTOS, L. E. S. ; STUTZ, B. ; BOMFIM, T. R. ; Brito-Moreira, J ; Figueiredo-Oliveira,F. ; Klein, W.L. ; FERREIRA, S. T. ; De Mello, F.G. . Inhibition of Choline Acetyltransferase as a Mechanism for ADDLs Induced Cholinergic Dysfunction.i. In: 8th IBRO World Congress of Neuroscience, 2011, Florence. Abstract of IBRO - 50th Anniversary. Florence: SINS, 2011.

  • Nunes-Tavares. N. ; SANTOS, L. E. S. ; Brito-Moreira, J ; BOMFIM, T. R. ; OLIVEIRA, F. F. ; FERREIRA, S. T. ; De Mello, F.G. . AB-DERIVED DIFFUSIBLE LIGANDS (ADDLS) INHIBIT CHOLINE ACETYLTRANSFERASE ACTIVITY IN CULTURED NEURONS.. In: SFN ? International meeting of Neuroscience, 2010, Washington. Abstract of SFN, 2010.

  • RIBEIRO, M. G. L. ; Oliveira, D.L. ; Nimrichter, L. ; Rodrigues, M.L. ; Nunes-Tavares. N. . Regulation of acetylcholinesterase and choline acetyltransferase by glucuronoxylomannan, the immunodominant polysaccharide produced by the neuropathogen Cryptococcus neoformans.. In: XXXIV Congresso anual da Sociedade Brasileira de Neurociências e Comportamento - SBNeC, 2010, Caxambú-MG. Livro de Resumos, 2010.

  • Nunes-Tavares. N. ; Camila Pinheiro de Almeida ; Brito-Moreira, J ; BOMFIM, T. R. ; Figueiredo-Oliveira,F. ; FERREIRA, S. T. ; De Mello, F.G. . SOLUBLE Aβ-OLIGOMERS (ADDLs) INHIBIT CHOLINE ACETYLTRANSFERASE (ChAT): PREVENTION BY POLYUNSATURATED FATTY ACIDS.. In: XIII ISCM, 2008, Foz do Iguaçu. Livro de resumos do XIII ISCM. Foz do Iguaçu, 2008.

  • Nunes-Tavares. N. ; DONG, L. ; LEROY, Jacqueline ; MASSOULIÉ, Jean . Identification of transcription factor promyelocytic Zinc finger protein (PLZF) as binding partner of Proline membrane anchor of acetylcholinesterase.. In: IXth International meeting on Cholinesterases, 2007, Suzhou - Shanghai. Program and abstract Book. Shanghai, 2007. p. 93-93.

  • Nunes-Tavares. N. ; Camila Pinheiro de Almeida ; Brito-Moreira, J ; BOMFIM, T. R. ; OLIVEIRA, F. F. ; FERREIRA, S. T. ; De Mello, F.G. . Choline Acetyltransferase (ChAT) Inhibition by soluble Ab-Oligomers (ADDLs) is mediated by Glutamatergics Receptors. In: XXII Reunião Anual da Federação de Sociedades de Biologia Experimental - FeSBE, 2007, Aguas de Lindoia - SP. Livro de Resumos. São Paulo-SP: ICB/SBIB, 2007. p. 81-81.

  • Camila Pinheiro de Almeida ; Nunes-Tavares. N. ; SANTOS, L. E. S. ; De Mello, F.G. . Chronic Glutamate treatment induces Nitric Oxide Synthase (NOS) Activity in Retinal Cell Cultures. In: XXII Reunião da Federação de Sociedades de Biologia Experimental - FeSBE, 2007, Aguas de Lindoia - SP. Livro de Resumos. São Paulo -SP: ICB/SBIB, 2007. p. 81-81.

  • Nunes-Tavares. N. ; Camila Pinheiro de Almeida ; De Mello, F.G. . Polyunsaturated Fatty Acids Prevent the Inhibition of Choline Acetyltransferase (ChAT) by Glutamate. In: XXII Reunião da Federação de Sociedades de Biologia Experimental - FeSBE, 2007, Aguas de Lindoia - SP. Livro de Resumos. Sao Paulo: ICB/SBIB, 2007. p. 81-81.

  • Nunes-Tavares. N. ; LEROY, Jacqueline ; MASSOULIÉ, Jean . IDENTIFICATION OF TRANSCRIPTION FACTOR PROMYELOCYTIC ZINC FINGER PROTEIN (PLZF) AS BINDING PARTNER OF PROLINE MEMBRANE ANCHOR (PRIMA) OF ACETYLCHOLINESTERASE.. In: XXI Congresso da Federação das Sociedades de Biologie Experimental, 2006, Aguas de Lindoia. Livro de Resumos. Sao Paulo: FESBE, 2006. p. 112-112.

  • Nunes-Tavares. N. ; LEROY, Jacqueline ; PERRIER, N. ; MASSOULIÉ, Jean . Identification of Novel Binding partner(s) for the Proline Rich Anchor (PRiMA) of acetylcholinesterase. In: XX Congresso da Federação das Sociedades de Biologie Experimental, 2005, Aguas de Lindoia - SP. Livro de resumo, 2005. p. 152-152.

  • Nunes-Tavares. N. ; LEROY, Jacqueline ; PERRIER, N. ; MASSOULIÉ, Jean . Identication of Novel Binding Partner(s) for the Proline Rich Membrane Anchor (PRiMA) of Acetylcholinesterase. In: XII INTERNATINAL SYMPOSIUM ON CHOLINERGIC MECHANISMS, 2005, ALICANTE - ESPANHA. Livro de Resumos, 2005. p. 116.

  • Nunes-Tavares. N. ; LEROY, Jacqueline ; PERRIER, N. ; MASSOULIÉ, Jean . Identification of novel binding partner(s) for the Proline Rich Membrane Anchor (PRiMA) of AChE using Yeast two hybrid system. In: Journées des Etudiants du Departament de Biologie de L'ENS/IFR 36, 2005. Livro de Resumo, 2005. v. Unico. p. 45-45.

  • FREITAS, C. F. ; Nunes-Tavares. N. ; L.E. Nascutti ; HASSON-VOLOCH, A. ; SILVA, L. C. F. . Expressão diferencial de glicosaminoglicanos sulfatados entre os três órgãos elétricos do Electrophorus electricus (L.). In: XXXII Congresso da Sociedade de Bioquímica e Biologia Molecular, 2003, Caxambú - MG. Livro de Resumos, 2003.

  • Lowe, J. ; ARAUJO, G. M. N. ; PEDRENHO, A. R. ; Nunes-Tavares. N. ; RIBEIRO, M. G. L. ; HASSON-VOLOCH, A. . Distribuição polarizada de isoformas da subunidade alfa da Na+,K+ ATPasenas faces de membrana diferenciadas do eletrócito.. In: XVIII Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 2003, Curitiba -PR. Livro de Resumos, 2003.

  • DUARTE, T. P. ; Lowe, J. ; Nunes-Tavares. N. ; ARAUJO, G. M. N. ; HASSON-VOLOCH, A. . Comparação das formas moleculares da Na+,K+ ATPase presente em eletrócitos por reações de fosforilação e defosforilação.. In: XVIII Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 2003, Curitiba - PR. Livro de Resumos, 2003.

  • Nunes-Tavares. N. ; Vieira, A.P.B. ; Loureiro dos Santos, N. ; de MELLO, M.C.F ; De Mello, F.G. . Inibição da Colina Acetiltransferase (ChAT) por amino ácidos excitatórios (AAE): Possível efeito protetor por agentes antioxidantes.. In: XVIII Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 2003, Curitiba-PR. Livro de Resumos, 2003.

  • Lowe, J. ; ARAUJO, G. M. N. ; PEDRENHO, A. R. ; Nunes-Tavares. N. ; RIBEIRO, M. G. L. ; HASSON-VOLOCH, A. . Polarized distribution of Na,K - ATPase alpha- subunit isoforms in electrocyte membranes. In: V Ibero American Congress of Biophysics, 2003, Rio de Janeiro. Livro de Resumos, 2003. p. 181-181.

  • FREITAS, Cristiano F. ; Nunes-Tavares. N. ; NASCIUTTI, Luiz E. ; HASSON-VOLOCH, A. ; SILVA, Luiz-claudio F. . Biochemistry and histochemistry of the Glycosaminoglycans isolated from the electric organs of the electric eel: Electrophorus electricus (L).. In: XXXII Reuniao Anual da Sociedade de Bioquimica e Biologia Molecular, 2003, Caxambú - MG. Livros de Resumos. Sao Paulo -SP, 2003. p. 159-159.

  • FREITAS, C. F. ; MULE, G. S. ; Camara-Lima, M. A. ; Nunes-Tavares. N. ; HASSON-VOLOCH, A. ; SILVA, L. C. F. . Glycoaminoglycans (GAGs) composition of the electric organ of Electrophorus electricus (L.). In: Congresso de Bioquimica, 2002, Caxambú-MG. Livro de Resumos, 2002.

  • Nunes-Tavares. N. ; NERY-DA-MATTA, A. R. ; BATISTA-E-SILVA, C. M. ; ARAUJO, G. M. N. ; LOURO, S. R. W. ; HASSON-VOLOCH, A. . Inhibitory effect of Tricyclic Antidepressants on Acetylcholinesterase activity. In: XIVth International Biophysics Congress (IUPAB), 2002, Buenos Aires-Arg. Livro de Resumos do congresso, 2002.

  • Nunes-Tavares. N. ; PEDRENHO, A. R. ; HASSONVOLOCH, A. . Caracterização Imunohistoquímica das subunidades a1 e a2 da Na,K ATPase no órgão elétrico Normal e Desnervado do E. electricus (L.). In: V Jornada Científica do Instituto de Biofísica Carlos chagas Filho - I Conferência Carlos Chagas Filho, 2002, Rio de Janeiro. Livro de Resumos, 2002. p. 58-58.

  • Vieira, A.P.B. ; Nunes-Tavares. N. ; Loureiro dos Santos, N. ; De Mello, M.C. ; De Mello, F.G. . Inibição da Colina Acetiltransferase (ChAT) por aminoácidos excitatórios (AAE): Possível efeito peotetor do Ascorbato.. In: V Jornada Científica do Instituto de Biofísica Carlos Chagas Filho - I Conferência Carlos Chagas Filho, 2002, Rio de Janeiro. Livro de resumo, 2002. p. 159-159.

  • Nunes-Tavares. N. ; VALVERDE, R. R. H. F. ; HASSON-VOLOCH, A. . Effects of Tricyclic Antidepressants on tha Cholinergic System. In: XVII Reunião Anual da Federação de Sociedades de Biologia Experimental - FeSBE, 2002, Salvador - BA. Compact Disc com resumos, 2002.

  • Nunes-Tavares. N. ; NERYDAMATTA, A. R. ; BATISTAESILVA, C. M. ; ARAUJO, G. N. ; LOURO, S. R. W. ; HASSONVOLOCH, A. . Caracterização do sítio de ligação de drogas antidepressivas na acetilcolinesterase usando propidium. In: XVI - Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 2001, Caxambú-MG. Livro de resumos da FeSBE, 2001.

  • PEDRENHO, A. R. ; Nunes-Tavares. N. ; HASSON-VOLOCH, A. . Caracterização imunohistoquímica da isoforma Alfa 1 da Na, K-ATPase no eletrócito Normal e Desnervado. In: XVI - Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 2001, Caxambú-MG. Livro de Resumos, 2001.

  • Nunes-Tavares. N. ; NERY-DA-MATTA, A. R. ; BATISTA-E-SILVA, C. M. ; ARAUJO, G. M. N. ; HASSON-VOLOCH, A. ; LOURO, S. R. W. . Inhibition of Acetylcholinesterase by tricylic Antideprerssants and binding site using Propidium Fluorescence. In: XXIV Encontro Nacional de Física da Matéria condensada, 2001, São Lourenço-MG. Livro de resumos, 2001.

  • Nunes-Tavares. N. ; BATISTA-E-SILVA, C. M. ; ARAUJO, G. M. N. ; NERY-DA-MATTA, A. R. ; HASSON-VOLOCH, A. ; LOURO, S. R. W. . Inhibition of Acetylcholinesterase by Tricyclic Antidepressants and Bindig Site Characterization using Propidium Fluorescence. In: XXIV Encontro Nacional de Fisica da Materia Condensada, 2001, São Lourenço -MG. Livro de Resumos, 2001.

  • RIBEIRO, M. G. L. ; Nunes-Tavares. N. ; REBELO, M. F. ; AMARAL, M. C. R. ; PFEIFFER, W. ; HASSON-VOLOCH, A. . Atividade da Na,K ATPase em ostras (Crassostrea rhizophorae) contaminadas por Zn e Cd.. In: IV SETAC LA - Latin American Meeting on Ecotoxicology, 2001, Buenos Aires. Livros de resumos, 2001.

  • Nunes-Tavares. N. ; HASSON-VOLOCH, A. ; ARAUJO, G. M. N. ; VALVERDE, R. R. H. . Inibição da Atividade da enzima Colina Acetiltransferase (ChAT) do órgão elétrico do Electrophorus electricus (L.) pelo Hg+2 e sua reversibilidade.. In: Reunião das Sociedades de Biologia Experimental (FeSBE), 2000, Caxambú - MG. Livro de resumos, 2000.

  • Nunes-Tavares. N. ; NERY-DA-MATTA, A. R. ; BATISTA-E-SILVA, C. M. ; ARAUJO, G. M. N. ; LOURO, S. R. W. ; HASSON-VOLOCH, A. . Binding of Antidepressants to acetylcholinesterase. Site characterization using propidium fluorescence. In: IV Congresso Internacional do cone Sul, 2000, Campinas-SP. Livro de resumos, 2000.

  • BATISTA-E-SILVA, C. M. ; Nunes-Tavares. N. ; NERY-DA-MATTA, A. R. ; SIMONE, S. G. ; HASSON-VOLOCH, A. . Purification and Partial characterization of creatine Kinase from electric organ of Electrophorus electricus (L.). In: XV - Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 2000, Caxambú-MG. Livro de Resumos, 2000.

  • VALVERDE, R. R. H. F. ; Nunes-Tavares. N. ; ARAUJO, G. M. N. ; HASSON-VOLOCH, A. . Reversible Inhibition by Mercury of choline Acetyltransferase from electric organ of Electrophorus electricus (L). In: IV Congresso Internacional do cone Sul, 2000, Campinas _SP. Livro de resumos, 2000.

  • Nunes-Tavares. N. ; CUNHAESILVA, N. L. ; HASSON-VOLOCH, A. . Análise da Colina Acetiltransferase em diferentes períodos de Desnervação. In: XIV - Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 1999, Caxambú-MG. Livro de resumos, 1999.

  • VALVERDE, R. R. H. ; Nunes-Tavares. N. ; ARAUJO, G. M. N. ; HASSON-VOLOCH, A. . Efeito do Mercúrio sobre a atividade da Colina Acetiltransferase. In: XIV - Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 1999, Caxambú-MG. Livro de resumos, 1999.

  • Nunes-Tavares. N. ; NERY-DA-MATTA, A. R. ; BATISTA-E-SILVA, C. M. ; ARAUJO, G. M. N. ; LOURO, S. R. W. ; HASSON-VOLOCH, A. . Inibição da Acetilcolinesterase (AChE) do órgão elétrico principal do Electrophorus electricus (L.) por antidepressívos tricíclicos aromáticos. In: XIII - Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 1998, Caxambú_MG. Livro de resumos, 1998.

  • BATISTA-E-SILVA, C. M. ; SÁ, P. G. ; Nunes-Tavares. N. ; HASSON-VOLOCH, A. . Produção de Anticorpo Policlonal anti-CPK usando-se bola de golfe implantada em coelho.. In: I - Encontro Científico da Sociedade Brasileira de biociências Nucleares / II - Encontro Científico de Biofísica e Biometria, 1997, Rio de Janeiro -RJ. Livro de resumos, 1997.

  • Nunes-Tavares. N. ; CUNHAESILVA, N. L. ; HASSON-VOLOCH, A. . Análise comparativa da Colina Acetiltransferase do órgão elétrico normal e desnervado do Electrophorus electricus (L.) por microscopia confocal.. In: XI - Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 1996, Caxambú-MG. Livro de resumos, 1996.

  • Nunes-Tavares. N. ; BATISTA-E-SILVA, C. M. ; HASSON-VOLOCH, A. . Análise da Colina acetiltransferase por métodos Físicoquímicos do órgão elétrico normal e desnervado do Electrophorus electricus (L.). In: XI - Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 1996, Caxambú-MG. Livro de Resumos, 1996.

  • Nunes-Tavares. N. ; CUNHAESILVA, N. L. ; HASSON-VOLOCH, A. . Physicochemical analysis and confocal microscopy of Choline Acetyltransferase from electrocyte of Normal and Denervated Electrophorus electricus (L.).. In: XIIth International Biophysics Congress (IUPAB), 1996, Amsterdam-Holand. Progress in Biophysic & Molecular Biology.. Oxford- England: Pergamon Elsevier Science, 1996. v. 65. p. 201-201.

  • Nunes-Tavares. N. ; HASSON-VOLOCH, A. . Characterization of Choline-O-Acetyltransferase of electric organ from Electrophorus electricus (L.). In: III Congresso Internacional do cone Sul, 1995, Belo Horizonte-MG. Livro de Resumos, 1995.

  • Nunes-Tavares. N. ; BATISTA-E-SILVA, C. M. ; HASSON-VOLOCH, A. . Caracterização Físicoquímica da Ch-O-AT do órgão elétrico do Electrophorus electricus (L.). In: IX - Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 1994, Caxambú_MG. Livro de resumos, 1994.

  • Nunes-Tavares. N. ; BATISTA-E-SILVA, C. M. ; HASSON-VOLOCH, A. . Atividade da enzima Ch-O-At do órgão elétrico do Electrophorus electricus (L.). In: VIII - Reunião da Federação das Sociedades de Biologia Experimental (FeSBE), 1993, Caxambú - MG. Livro de resumos, 1993.

  • Nunes-Tavares. N. ; CUNHAESILVA, N. L. ; HASSON-VOLOCH, A. . Physicochemical analysis and confocal microscopy of Choline Acetyltransferase from electrocyte of Normal and Denervated Electrophorus electricus (L.). Progress in Biophysics and Molecular Biology , England, v. 65, p. 201-201, 1996.

  • GRANJA, M. G. ; BRAGA, L. E. G. ; CARPI-SANTOS, R. ; ARAUJO-MARTINS, L. ; Nunes-Tavares. N. ; CALAZA, K. C. ; RABELO, A. A. S. ; GIESTAL-DE-ARAUJO, E. . IL-4 Induces Cholinergic Differentiation of Retinal Cells In vitro. Cellular and Molecular Neurobiology , 2015.

  • Nunes-Tavares. N. ; Santos, L.E.S. ; Stutz, B. ; Brito-Moreira, J ; Klein, W.L. ; FERREIRA, S. T. ; De Mello, F.G. . Inhibition of choline acetyltransferase as a mechanism for cholinergic dysfunction induced by amyloid-β oligomers. The Journal of Biological Chemistry (Print) , 2012.

  • Nunes-Tavares. N. . Os impactos ambientais e suas implicações para a saúde do Cérebro.. 2013. (Apresentação de Trabalho/Conferência ou palestra).

  • SANTOS, L. E. ; Nunes-Tavares. N. ; FERREIRA, S. T. ; De Mello, F.G. . Loss of choline acetyltransferase activity caused by oxidative damage: Mechanisms and possible implications for Alzheimer?s disease. 2013. (Apresentação de Trabalho/Comunicação).

  • Nunes-Tavares. N. ; SANTOS, L. E. S. ; STUTZ, B. ; BOMFIM, T. R. ; Brito-Moreira, J ; OLIVEIRA, F. F. ; Klein, W.L. ; FERREIRA, S. T. ; De Mello, F.G. . 8th IBRO World Congress of Neuroscience. 2011. (Apresentação de Trabalho/Congresso).

  • ANA, R. A. S. ; Gomes,T. ; Nunes-Tavares. N. . XIII Encontro Regional da Sociedade Brasileira de Quimica. 2011. (Apresentação de Trabalho/Outra).

  • RIBEIRO, M. G. L. ; Oliveira, D.L. ; Nimrichter, L. ; Rodrigues, M.L. ; Nunes-Tavares. N. . XXXIV Congresso Anual da Sociedade Brasileira de Neurociencias e Comportamento. 2010. (Apresentação de Trabalho/Congresso).

  • DONG, L. ; Nunes-Tavares. N. ; Heidi Q. Xie ; Carvalho,S. ; Bon,S. ; MASSOULIÉ, Jean . mCutA, acetylcholinesterase and secretory trafficking. 2008. (Apresentação de Trabalho/Simpósio).

  • Nunes-Tavares. N. . Neuroquímica do Sistema Colinérgico : O papel de agentes citotóxicos.. 2008. (Apresentação de Trabalho/Conferência ou palestra).

  • Nunes-Tavares. N. . Homenagem à Dra Aida Hassón-Voloch. 2008. (Apresentação de Trabalho/Comunicação).

Seção coletada automaticamente pelo Escavador

Outras produções

Nunes-Tavares. N. . Responsavel Técnico. 2013.

RIBEIRO, M. G. L. ; Nunes-Tavares. N. ; Benchimol, M. . Qualidade da Agua. 2007. (Curso de curta duração ministrado/Extensão).

Nunes-Tavares. N. ; Ayres Sá, L. ; Pires de Carvalho, D. . Peixe elétrico da Amazonia. 2011 (Video Educacional) .

Nunes-Tavares. N. . Bioeletrogênese. 2011 (Treinameto de monitores) .

Seção coletada automaticamente pelo Escavador

Projetos de pesquisa

  • 2006 - Atual

    Neurotransmissores e neuromoduladores na altaeração funcional de sinapses quimicas e identificação de moléculas na definiçaão de fenotipos neuroquimicos, Descrição: Identificar novas substancias e/ou moléculas que possam influenciar na alteração funcional de sinapses quimicas colinérgicas.. , Situação: Em andamento; Natureza: Pesquisa. , Alunos envolvidos: Graduação: (0) / Especialização: (0) / Mestrado acadêmico: (0) / Mestrado profissional: (0) / Doutorado: (0) . , Integrantes: Nilson Nunes Tavares - Coordenador / Glaucia Slana - Integrante., Financiador(es): Fundação Carlos Chagas Filho de Amparo à Pesquisa do Estado do RJ - Bolsa.

  • 2004 - 2006

    A search of binding partners of the C-terminal peptide of PRiMA I by two-hybrid strategies, Descrição: In the mammalian brain, the major form of AChE is a tetramer of AChET subunits, anchored in cell membranes by the transmembrane protein PRiMA. PRiMA was found to be mostly expressed in cholinergic neurons, characterized by the expression of choline acetyl transferase (Perrier). This suggests that PRiMA-anchored AChE may be associated with presynaptic nerve endings in the central nervous system. PRiMA is a single pass type transmembrane protein of about 20 kDa, which associates with AChET subunits through its proline-rich PRAD motif, located in the extracellular domain. It presents two splice variants, differing by their C-terminal cytoplasmic domains. In addition to the first seven residues, which are common to both variants, the cytoplasmic domain of the longer splice variant (PRiMA I) contains only four residues. The cytoplasmic domain of PRiMA I is well conserved among mammals, e.g. between mouse and man . mouse CYKAIKRKPLRKDENGTSVAEYPMSSSQSHKGVDVNAAVV human CYKAIKRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV PRiMA I is largely predominant in the adult brain. PRiMA II is expressed at a very low level in the forebrain, and corresponds to about 10% of transcripts in the cerebellum. Its proportion is higher in the embryonic brain. Although both variants can anchor PRiMA-associated AChET tetramers in cell membranes, this regulation suggests that the cytoplasmic domain of PRiMA I represents a more mature form, and perhaps allows a more precise location of AChE at cholinergic sites in neuronal membranes.. , Situação: Concluído; Natureza: Pesquisa. , Alunos envolvidos: Doutorado: (1) . , Integrantes: Nilson Nunes Tavares - Coordenador / Jacqueline Leroy - Integrante / Jean Massoulié - Integrante / Liang Dong - Integrante / Suzanne Bon - Integrante.

  • 2002 - Atual

    Papel de Neurotransmissores e neuromoduladores na altração funcional de sinapses quimicas e na definição de fenotipos neuroqimicos, Descrição: O sistema colinérgico é responsavel pelo metabolismo e sinalização de Acetilcolina no sistema nervoso central e tem atraido, no ultimos anos a atenção para o seu envolvimento com as alterações provocados em diversas pataologias, como a Doença de Alzheimer. A diminuição da enzima de sintese, a Colina acetiltransferase em hipocampos de pacientes com Alzheimer, tem sugerido que a disfunção neuroquimica primaria que leva as alterações de memoria e posteriormente a outras areas cognitivas do cérebro........ , Situação: Em andamento; Natureza: Pesquisa. , Alunos envolvidos: Graduação: (0) / Especialização: (0) / Mestrado acadêmico: (1) / Mestrado profissional: (0) / Doutorado: (0) . , Integrantes: Nilson Nunes Tavares - Integrante / Fernando Garcia de Mello - Coordenador / Maria Cristina Fialho de Mello - Integrante / Camila Pinheiro de Almeida - Integrante., Financiador(es): Conselho Nacional de Desenvolvimento Científico e Tecnológico - Auxílio financeiro / Fundação Carlos Chagas Filho de Amparo à Pesquisa do Estado do RJ - Auxílio financeiro.Número de orientações: 1

Seção coletada automaticamente pelo Escavador

Projetos de desenvolvimento

  • 2014 - Atual

    Reestruturação do laboratório de química ambiental da Faculdade de Educação Tecnológica do Estado do Rio de Janeiro (Faeterj) - Paracambi., Descrição: O projeto visa detalhar a importância da reestruturação do Laboratório de Química Ambiental, para o Curso Superior de Tecnologia em Gestão Ambiental com o intuito de atingir os seguintes objetivos: possibilitar aulas práticas de Química (Química Geral, Química Ambiental Orgânica, Química Ambiental Inorgânica, Química Analítica), Biomonitoramento de Ecossistemas Aquáticos, Controle da Poluição das Águas, Ecologia de Rios e Bacias Hidrográficas, Controle da Poluição do Solo, Biorremediação de Solos e Aquíferos Contaminados e Saúde Pública; viabilizar pesquisas envolvendo a análise e o monitoramento ambiental de ecossistemas contaminados por rejeitos resíduos químicos e os possíveis efeitos destes na saúde pública da região; viabilizar pesquisas para o controle da qualidade ambiental; possibilitar prática de monitoramentos dos impactos da poluição ambiental; possibilitar prática de controle de rejeitos resíduos industriais e permitir a implantação imediata de linhas de pesquisas para suporte acadêmico na FAETERJ Paracambi. Palavra-chave: Laboratório de Química Ambiental,. , Situação: Em andamento; Natureza: Desenvolvimento. , Alunos envolvidos: Graduação: (80) / Especialização: (10) . , Integrantes: Nilson Nunes Tavares - Coordenador / Romilda Lemos - Integrante / Cinthia da Silva Lisboa - Integrante / Antonio Orlando Izolani - Integrante., Financiador(es): FAPERJ - Auxílio financeiro.

  • 2014 - Atual

    Reestruturação do laboratório de química ambiental da Faculdade de Educação Tecnológica do Estado do Rio de Janeiro (Faeterj) - Paracambi., Descrição: O projeto visa detalhar a importância da reestruturação do Laboratório de Química Ambiental, para o Curso Superior de Tecnologia em Gestão Ambiental com o intuito de atingir os seguintes objetivos: possibilitar aulas práticas de Química (Química Geral, Química Ambiental Orgânica, Química Ambiental Inorgânica, Química Analítica), Biomonitoramento de Ecossistemas Aquáticos, Controle da Poluição das Águas, Ecologia de Rios e Bacias Hidrográficas, Controle da Poluição do Solo, Biorremediação de Solos e Aquíferos Contaminados e Saúde Pública; viabilizar pesquisas envolvendo a análise e o monitoramento ambiental de ecossistemas contaminados por rejeitos resíduos químicos e os possíveis efeitos destes na saúde pública da região; viabilizar pesquisas para o controle da qualidade ambiental; possibilitar prática de monitoramentos dos impactos da poluição ambiental; possibilitar prática de controle de rejeitos resíduos industriais e permitir a implantação imediata de linhas de pesquisas para suporte acadêmico na FAETERJ Paracambi. Palavra-chave: Laboratório de Química Ambiental,. , Situação: Em andamento; Natureza: Desenvolvimento. , Alunos envolvidos: Graduação: (80) / Especialização: (10) . , Integrantes: Nilson Nunes Tavares - Coordenador / Romilda Lemos - Integrante / Cinthia da Silva Lisboa - Integrante / Antonio Orlando Izolani - Integrante., Financiador(es): FAPERJ - Auxílio financeiro.

  • 2014 - Atual

    Reestruturação do laboratório de química ambiental da Faculdade de Educação Tecnológica do Estado do Rio de Janeiro (Faeterj) - Paracambi., Descrição: O projeto visa detalhar a importância da reestruturação do Laboratório de Química Ambiental, para o Curso Superior de Tecnologia em Gestão Ambiental com o intuito de atingir os seguintes objetivos: possibilitar aulas práticas de Química (Química Geral, Química Ambiental Orgânica, Química Ambiental Inorgânica, Química Analítica), Biomonitoramento de Ecossistemas Aquáticos, Controle da Poluição das Águas, Ecologia de Rios e Bacias Hidrográficas, Controle da Poluição do Solo, Biorremediação de Solos e Aquíferos Contaminados e Saúde Pública; viabilizar pesquisas envolvendo a análise e o monitoramento ambiental de ecossistemas contaminados por rejeitos resíduos químicos e os possíveis efeitos destes na saúde pública da região; viabilizar pesquisas para o controle da qualidade ambiental; possibilitar prática de monitoramentos dos impactos da poluição ambiental; possibilitar prática de controle de rejeitos resíduos industriais e permitir a implantação imediata de linhas de pesquisas para suporte acadêmico na FAETERJ Paracambi. Palavra-chave: Laboratório de Química Ambiental,. , Situação: Em andamento; Natureza: Desenvolvimento. , Alunos envolvidos: Graduação: (80) / Especialização: (10) . , Integrantes: Nilson Nunes Tavares - Coordenador / Romilda Lemos - Integrante / Cinthia da Silva Lisboa - Integrante / Antonio Orlando Izolani - Integrante., Financiador(es): FAPERJ - Auxílio financeiro.

  • 2014 - Atual

    Reestruturação do laboratório de química ambiental da Faculdade de Educação Tecnológica do Estado do Rio de Janeiro (Faeterj) - Paracambi., Descrição: O projeto visa detalhar a importância da reestruturação do Laboratório de Química Ambiental, para o Curso Superior de Tecnologia em Gestão Ambiental com o intuito de atingir os seguintes objetivos: possibilitar aulas práticas de Química (Química Geral, Química Ambiental Orgânica, Química Ambiental Inorgânica, Química Analítica), Biomonitoramento de Ecossistemas Aquáticos, Controle da Poluição das Águas, Ecologia de Rios e Bacias Hidrográficas, Controle da Poluição do Solo, Biorremediação de Solos e Aquíferos Contaminados e Saúde Pública; viabilizar pesquisas envolvendo a análise e o monitoramento ambiental de ecossistemas contaminados por rejeitos resíduos químicos e os possíveis efeitos destes na saúde pública da região; viabilizar pesquisas para o controle da qualidade ambiental; possibilitar prática de monitoramentos dos impactos da poluição ambiental; possibilitar prática de controle de rejeitos resíduos industriais e permitir a implantação imediata de linhas de pesquisas para suporte acadêmico na FAETERJ Paracambi. Palavra-chave: Laboratório de Química Ambiental,. , Situação: Em andamento; Natureza: Desenvolvimento. , Alunos envolvidos: Graduação: (80) / Especialização: (10) . , Integrantes: Nilson Nunes Tavares - Coordenador / Romilda Lemos - Integrante / Cinthia da Silva Lisboa - Integrante / Antonio Orlando Izolani - Integrante., Financiador(es): FAPERJ - Auxílio financeiro.

Seção coletada automaticamente pelo Escavador

Prêmios

2011

APQ5 - Auxilio Viagem FAPERJ - 8th IBRO, FAPERJ - Fundação Carlos Chagas Filho de Amparo à Pesquisa do Estado do Rio de Janeiro.

2007

Scholarships, IBRO/ISN.

2002

Wellcome Trust, IUPAB.

1996

Fellowship Travel, IUPAB.

Histórico profissional

Seção coletada automaticamente pelo Escavador

Endereço profissional

  • Universidade Federal do Rio de Janeiro, Instituto de Biofísica Carlos Chagas Filho, Centro de Ciencias da Saude. , UFRJ - CCS - BL.G 037 - AV. BRIGADEIRO TROMPOWSKI, ILHA DO FUNDAO, 21949-900 - Rio de Janeiro, RJ - Brasil, Telefone: (21) 25626594, Fax: (21) 22808193

Seção coletada automaticamente pelo Escavador

Experiência profissional

  • 2010 - 2014

    Fundação de Apoio à Escola Técnica do Estado do Rio de Janeiro

    Vínculo: Contrato Temporario, Enquadramento Funcional: Professor I, Carga horária: 20

    Outras informações:
    Professor de Quimica Inorganica e Quimica Analitica para o curso de gestao Ambiental

    Atividades

    • 10/2010

      Ensino, Quimica, Nível: Graduação,Disciplinas ministradas, Quimica Inorganica e Quimica Analitica, para curso de Tecnologo em Gestão Ambiental

  • 1997 - 2003

    Universidade Iguaçú

    Vínculo: Celetista, Enquadramento Funcional: Professor, Carga horária: 20

    Outras informações:
    Professor II

    Atividades

    • 03/1997 - 08/2003

      Ensino, Medicina, Nível: Graduação,Disciplinas ministradas, Biofísica

  • 2004 - 2006

    École Normale Supérieure - Paris

    Vínculo: Pesquisador, Enquadramento Funcional: Pos-Doutorado, Carga horária: 40, Regime: Dedicação exclusiva.

    Atividades

    • 04/2004 - 12/2005

      Pesquisa e desenvolvimento , Ecole Normale Superieure - Paris, .,Linhas de pesquisa

  • 2006 - 2009

    Universidade Estadual da Zona Oeste

    Vínculo: Professor, Enquadramento Funcional: Professor Temporario, Carga horária: 40

    Atividades

    • 02/2006

      Pesquisa e desenvolvimento , Universidade Estadual da Zona Oeste, .,Linhas de pesquisa

    • 02/2004

      Ensino, Tecnologia em Polimeros, Biofarmacos, Biotecnologi, Nível: Graduação,Disciplinas ministradas, Quimica Geral e Analitica

  • 2006 - Atual

    Universidade Federal do Rio de Janeiro

    Vínculo: Pos Doc, Enquadramento Funcional: Tecnico Quimico, Carga horária: 40

    Outras informações:
    Participaçao deprojetos em Neuroquimica. Estudo dos efeitos de EAA no sistema nervoso colinégico.

  • 1985 - Atual

    Universidade Federal do Rio de Janeiro

    Vínculo: Servidor Público, Enquadramento Funcional: Técnico Químico, Carga horária: 40

    Atividades

    • 01/1990 - 02/2002

      Pesquisa e desenvolvimento , Instituto de Biofísica Carlos Chagas Filho, .,Linhas de pesquisa

    • 09/1985 - 02/2002

      Serviços técnicos especializados , Instituto de Biofísica Carlos Chagas Filho, Programa de Biofísica.,Serviço realizado, Colaborador em cursos de Pos Gradução e Projetos de Pesquisa do Laboratorio de Fisico-Quimica Biologica AHV..

    • 02/1995 - 06/1995

      Ensino, Biociencias, Nível: Graduação,Disciplinas ministradas, Biofisica

    • 08/1993 - 07/1994

      Ensino, Farmacia, Nível: Graduação,Disciplinas ministradas, Programa de Orientação Academica (POA III)

  • 2004 - 2004

    Centro Universitário Serra dos Órgãos

    Vínculo: Colaborador, Enquadramento Funcional: Professor, Carga horária: 20

    Atividades

    • 02/2004 - 04/2004

      Ensino, Medicina, Nível: Graduação,Disciplinas ministradas, Biofisica

  • 2015 - 2016

    Secretaria de Educação do Estado do Rio de Janeiro - Santo Cristo

    Vínculo: Professor contrato Temporario, Enquadramento Funcional: Professor Temporario, Carga horária: 12

    Outras informações:
    Professor de Quimica

  • 2004 - Atual

    Instituto de biofísica Carlos Chagas Filho

    Vínculo: Servidor Público, Enquadramento Funcional: Responsavel Tecnico

    Outras informações:
    Responsavel Ténico, CRQ, junto ao Exercito Brasileiro e Policia Federal, para aquisição de substancias controladas.

  • 2012 - 2016

    Faculdade São Camilo

    Vínculo: Professor Visitante, Enquadramento Funcional: Professor